Recombinant Human RCAN1 Protein, GST-tagged

Cat.No. : RCAN1-4029H
Product Overview : Human DSCR1 full-length ORF ( AAH02864, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Molecular Mass : 47.41 kDa
AA Sequence : MEEVDLRDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTQIHLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RCAN1 regulator of calcineurin 1 [ Homo sapiens ]
Official Symbol RCAN1
Synonyms RCAN1; regulator of calcineurin 1; Down syndrome critical region gene 1 , DSCR1; calcipressin-1; near DSCR proline-rich protein; Down syndrome candidate region 1; calcium and oxidant-inducible mRNA; Down syndrome critical region gene 1; down syndrome critical region protein 1; modulatory calcineurin-interacting protein 1; myocyte-enriched calcineurin-interacting protein 1; CSP1; DSC1; RCN1; DSCR1; MCIP1; ADAPT78;
Gene ID 1827
mRNA Refseq NM_004414
Protein Refseq NP_004405
MIM 602917
UniProt ID P53805

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCAN1 Products

Required fields are marked with *

My Review for All RCAN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon