Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RCC1-2204H |
Product Overview : | SNHG3 MS Standard C13 and N15-labeled recombinant protein (NP_001041664) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA. |
Molecular Mass : | 45 kDa |
AA Sequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ] |
Official Symbol | RCC1 |
Synonyms | RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1; |
Gene ID | 1104 |
mRNA Refseq | NM_001048199 |
Protein Refseq | NP_001041664 |
MIM | 179710 |
UniProt ID | P18754 |
◆ Recombinant Proteins | ||
RCC1-01H | Recombinant Full Length Human RCC1 protein, His-tagged | +Inquiry |
RCC1-1139H | Recombinant Human Regulator Of Chromosome Condensation 1 | +Inquiry |
Rcc1-019M | Recombinant Full Length Mouse Rcc1 Protein, MYC/DDK-tagged | +Inquiry |
RCC1-181H | Recombinant Human RCC1 Protein, Strep-tagged | +Inquiry |
RCC1-1868H | Recombinant Human RCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
0
Inquiry Basket