Recombinant Full Length Human RCC1 Protein, C-Flag-tagged
Cat.No. : | RCC1-738HFL |
Product Overview : | Recombinant Full Length Human RCC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including guanyl-nucleotide exchange factor activity; nucleosomal DNA binding activity; and protein heterodimerization activity. Involved in several processes, including G1/S transition of mitotic cell cycle; regulation of mitotic nuclear division; and spindle organization. Located in chromatin; cytoplasm; and nucleus. Part of protein-containing complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ STRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RCC1 regulator of chromosome condensation 1 [ Homo sapiens (human) ] |
Official Symbol | RCC1 |
Synonyms | CHC1; RCC1-I |
Gene ID | 1104 |
mRNA Refseq | NM_001269.6 |
Protein Refseq | NP_001260.1 |
MIM | 179710 |
UniProt ID | P18754 |
◆ Recombinant Proteins | ||
RCC1-2204H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rcc1-019M | Recombinant Full Length Mouse Rcc1 Protein, MYC/DDK-tagged | +Inquiry |
RCC1-1868H | Recombinant Human RCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RCC1-12391Z | Recombinant Zebrafish RCC1 | +Inquiry |
RCC1-1340H | Recombinant Human RCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCC1 Products
Required fields are marked with *
My Review for All RCC1 Products
Required fields are marked with *
0
Inquiry Basket