Recombinant Human RCOR1 protein, GST-tagged
Cat.No. : | RCOR1-73H |
Product Overview : | Recombinant Human RCOR1(1 a.a. - 482 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-482 a.a. |
Description : | This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 79.97 kDa |
AA Sequence : | MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAP NGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYI AIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIAS LVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHST QAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEV IQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPS NQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RCOR1 REST corepressor 1 [ Homo sapiens ] |
Official Symbol | RCOR1 |
Synonyms | RCOR1; REST corepressor 1; RCOR, REST corepressor; COREST; KIAA0071; RCOR; |
Gene ID | 23186 |
mRNA Refseq | NM_015156 |
Protein Refseq | NP_055971 |
MIM | 607675 |
UniProt ID | Q9UKL0 |
Chromosome Location | 14q32.33 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; protein binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
RCOR1-1852H | Recombinant Human REST Corepressor 1, His-tagged | +Inquiry |
RCOR1-301383H | Recombinant Human RCOR1 protein, GST-tagged | +Inquiry |
RCOR1-7502M | Recombinant Mouse RCOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RCOR1-14038M | Recombinant Mouse RCOR1 Protein | +Inquiry |
RCOR1-71H | Recombinant Human RCOR1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCOR1 Products
Required fields are marked with *
My Review for All RCOR1 Products
Required fields are marked with *