Recombinant Human RELA

• Cat.No.: RELA-30386TH
• Product Overview: Recombinant fragment corresponding to amino acids 432-505 of Human NFkB p65 with a N terminal proprietary tag; predicted MWt 33.77 kDa inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 74 amino acids
• Description: NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 33.770kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT
• Sequence Similarities: Contains 1 RHD (Rel-like) domain.

Gene Information

• Gene Name: RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ]
• Official Symbol: RELA
• Synonyms: RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65
• Gene ID: 5970
• mRNA Refseq: NM_001145138
• Protein Refseq: NP_001138610
• MIM: 164014
• Uniprot ID: Q04206
• Chromosome Location: 11q13
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem
• Function: DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding