Recombinant Human RELA
| Cat.No. : | RELA-30386TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 432-505 of Human NFkB p65 with a N terminal proprietary tag; predicted MWt 33.77 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 74 amino acids |
| Description : | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 33.770kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT |
| Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
| Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
| Official Symbol | RELA |
| Synonyms | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; |
| Gene ID | 5970 |
| mRNA Refseq | NM_001145138 |
| Protein Refseq | NP_001138610 |
| MIM | 164014 |
| Uniprot ID | Q04206 |
| Chromosome Location | 11q13 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
| Function | DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding; |
| ◆ Recombinant Proteins | ||
| RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
| RELA-6686C | Recombinant Chicken RELA | +Inquiry |
| RELA-248Z | Recombinant Zebrafish RELA | +Inquiry |
| RELA-30384TH | Recombinant Human RELA | +Inquiry |
| RELA-611H | Recombinant Human RELA protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *
