Recombinant Human RELA
Cat.No. : | RELA-30386TH |
Product Overview : | Recombinant fragment corresponding to amino acids 432-505 of Human NFkB p65 with a N terminal proprietary tag; predicted MWt 33.77 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 74 amino acids |
Description : | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 33.770kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT |
Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol | RELA |
Synonyms | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; |
Gene ID | 5970 |
mRNA Refseq | NM_001145138 |
Protein Refseq | NP_001138610 |
MIM | 164014 |
Uniprot ID | Q04206 |
Chromosome Location | 11q13 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
Function | DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding; |
◆ Recombinant Proteins | ||
RELA-6166H | Recombinant Human RELA Protein (Met1-Gln220), N-His tagged | +Inquiry |
RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
RELA-1878H | Recombinant Human RELA Protein, His (Fc)-Avi-tagged | +Inquiry |
RELA-6165H | Recombinant Human RELA Protein (Pro19-Asp291), C-His tagged | +Inquiry |
RELA-634H | Recombinant Human RELA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *