Recombinant Human RELA Protein, GST-tagged

Cat.No. : RELA-729H
Product Overview : Recombinant Human RELA Protien(NP_001138610)(1-220 aa), fused to GST tag, was expressed in E. coli.
Availability July 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-220 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ]
Official Symbol RELA
Synonyms RELA; transcription factor p65; p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; NFKB3; MGC131774;
Gene ID 5970
mRNA Refseq NM_001145138
Protein Refseq NP_001138610
MIM 164014
UniProt ID Q04206

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RELA Products

Required fields are marked with *

My Review for All RELA Products

Required fields are marked with *

0
cart-icon