Recombinant Human RELA Protein, GST-tagged
Cat.No. : | RELA-729H |
Product Overview : | Recombinant Human RELA Protien(NP_001138610)(1-220 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-220 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol | RELA |
Synonyms | RELA; transcription factor p65; p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; NFKB3; MGC131774; |
Gene ID | 5970 |
mRNA Refseq | NM_001145138 |
Protein Refseq | NP_001138610 |
MIM | 164014 |
UniProt ID | Q04206 |
◆ Recombinant Proteins | ||
RELA-7009H | Recombinant Human RELA protein, GST-tagged | +Inquiry |
Rela-612M | Recombinant Mouse Rela protein, His & T7-tagged | +Inquiry |
RELA-3525H | Recombinant Human RELA protein, His-tagged | +Inquiry |
RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
RELA-622H | Recombinant Human RELA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *
0
Inquiry Basket