Recombinant Human RELA Protein, GST-tagged
| Cat.No. : | RELA-729H |
| Product Overview : | Recombinant Human RELA Protien(NP_001138610)(1-220 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-220 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
| Official Symbol | RELA |
| Synonyms | RELA; transcription factor p65; p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; NFKB3; MGC131774; |
| Gene ID | 5970 |
| mRNA Refseq | NM_001145138 |
| Protein Refseq | NP_001138610 |
| MIM | 164014 |
| UniProt ID | Q04206 |
| ◆ Recombinant Proteins | ||
| RELA-6165H | Recombinant Human RELA Protein (Pro19-Asp291), C-His tagged | +Inquiry |
| RELA-248Z | Recombinant Zebrafish RELA | +Inquiry |
| Rela-5456M | Recombinant Mouse Rela Protein, Myc/DDK-tagged | +Inquiry |
| RELA-2484H | Recombinant Human RELA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RELA-11HFL | Active Recombinant Full Length Human RELA Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *




