Recombinant Human RHOA, GST-tagged
Cat.No. : | RHOA-301418H |
Product Overview : | Recombinant Human GFP (123-161 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn123-Ala161 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RHOA ras homolog family member A [ Homo sapiens ] |
Official Symbol | RHOA |
Synonyms | RHOA; ras homolog family member A; ARH12, ARHA, ras homolog gene family, member A; transforming protein RhoA; Rho12; RhoA; RHOH12; h12; oncogene RHO H12; rho cDNA clone 12; Aplysia ras-related homolog 12; small GTP binding protein RhoA; ras homolog gene family, member A; ARHA; ARH12; RHO12; |
Gene ID | 387 |
mRNA Refseq | NM_001664 |
Protein Refseq | NP_001655 |
MIM | 165390 |
UniProt ID | P61586 |
◆ Recombinant Proteins | ||
RHOA-5035R | Recombinant Rat RHOA Protein | +Inquiry |
RHOA-3975H | Recombinant Full Length Human RHOA Protein, His-tagged | +Inquiry |
RHOA-160H | Recombinant Human RHOA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RHOA-1145H | Recombinant Human Ras Homolog Gene Family, Member A | +Inquiry |
RHOA-2117HFL | Recombinant Full Length Human RHOA Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOA Products
Required fields are marked with *
My Review for All RHOA Products
Required fields are marked with *