Recombinant Human RHOA, GST-tagged

• Cat.No.: RHOA-301418H
• Product Overview: Recombinant Human GFP (123-161 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn123-Ala161
• AA Sequence: NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RHOA ras homolog family member A [ Homo sapiens ]
• Official Symbol: RHOA
• Synonyms: RHOA; ras homolog family member A; ARH12, ARHA, ras homolog gene family, member A; transforming protein RhoA; Rho12; RhoA; RHOH12; h12; oncogene RHO H12; rho cDNA clone 12; Aplysia ras-related homolog 12; small GTP binding protein RhoA; ras homolog gene family, member A; ARHA; ARH12; RHO12
• Gene ID: 387
• mRNA Refseq: NM_001664
• Protein Refseq: NP_001655
• MIM: 165390
• UniProt ID: P61586