Recombinant Human RNASE4 Protein (29-147 aa), His-MBP-tagged
Cat.No. : | RNASE4-2747H |
Product Overview : | Recombinant Human RNASE4 Protein (29-147 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 29-147 aa |
Description : | This RNase has marked specificity towards the 3' side of uridine nucleotides. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 57.8 kDa |
AA Sequence : | QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RNASE4 ribonuclease A family member 4 [ Homo sapiens (human) ] |
Official Symbol | RNASE4 |
Synonyms | RNASE4; RAB1; RNS4; |
Gene ID | 6038 |
mRNA Refseq | NM_001282192 |
Protein Refseq | NP_001269121 |
UniProt ID | P34096 |
◆ Recombinant Proteins | ||
RNASE4-2552H | Recombinant Human RNASE4 Protein (29-147 aa), His-sumostar-tagged | +Inquiry |
RNASE4-5062R | Recombinant Rat RNASE4 Protein | +Inquiry |
RNASE4-3580H | Recombinant Human RNASE4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNASE4-3434H | Recombinant Human RNASE4 protein, His&Myc-tagged | +Inquiry |
RNASE4-7921H | Recombinant Human RNASE4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE4-2319HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
RNASE4-2318HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNASE4 Products
Required fields are marked with *
My Review for All RNASE4 Products
Required fields are marked with *
0
Inquiry Basket