Recombinant Human RNASE4 Protein (29-147 aa), His-MBP-tagged

Cat.No. : RNASE4-2747H
Product Overview : Recombinant Human RNASE4 Protein (29-147 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 29-147 aa
Description : This RNase has marked specificity towards the 3' side of uridine nucleotides.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 57.8 kDa
AA Sequence : QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RNASE4 ribonuclease A family member 4 [ Homo sapiens (human) ]
Official Symbol RNASE4
Synonyms RNASE4; RAB1; RNS4;
Gene ID 6038
mRNA Refseq NM_001282192
Protein Refseq NP_001269121
UniProt ID P34096

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASE4 Products

Required fields are marked with *

My Review for All RNASE4 Products

Required fields are marked with *

0
cart-icon
0
compare icon