Recombinant Human RNF135 protein, His-tagged
Cat.No. : | RNF135-501H |
Product Overview : | Recombinant Human RNF135 protein(NP_001171921)(1-210 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-210 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RNF135 ring finger protein 135 [ Homo sapiens ] |
Official Symbol | RNF135 |
Synonyms | RNF135; ring finger protein 135; E3 ubiquitin-protein ligase RNF135; MGC13061; riplet; RIG-I E3 ubiquitin ligase; L13; MMFD; REUL; Riplet; |
Gene ID | 84282 |
mRNA Refseq | NM_001184992 |
Protein Refseq | NP_001171921 |
MIM | 611358 |
UniProt ID | Q8IUD6 |
◆ Recombinant Proteins | ||
RNF135-689H | Recombinant Human RNF135 Protein, MYC/DDK-tagged | +Inquiry |
RNF135-0411H | Recombinant Human RNF135 Protein (A2-V432), His tagged | +Inquiry |
Rnf135-5546M | Recombinant Mouse Rnf135 Protein, Myc/DDK-tagged | +Inquiry |
RNF135-5071R | Recombinant Rat RNF135 Protein | +Inquiry |
RNF135-0410H | Recombinant Human RNF135 Protein (A2-V432), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF135-1519HCL | Recombinant Human RNF135 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF135 Products
Required fields are marked with *
My Review for All RNF135 Products
Required fields are marked with *
0
Inquiry Basket