Recombinant Human RNF135 protein, His-tagged
| Cat.No. : | RNF135-501H |
| Product Overview : | Recombinant Human RNF135 protein(1-210 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-210 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RNF135 ring finger protein 135 [ Homo sapiens ] |
| Official Symbol | RNF135 |
| Synonyms | RNF135; ring finger protein 135; E3 ubiquitin-protein ligase RNF135; MGC13061; riplet; RIG-I E3 ubiquitin ligase; L13; MMFD; REUL; Riplet; |
| Gene ID | 84282 |
| mRNA Refseq | NM_001184992 |
| Protein Refseq | NP_001171921 |
| MIM | 611358 |
| UniProt ID | Q8IUD6 |
| ◆ Recombinant Proteins | ||
| RNF135-0410H | Recombinant Human RNF135 Protein (A2-V432), Tag Free | +Inquiry |
| Rnf135-5546M | Recombinant Mouse Rnf135 Protein, Myc/DDK-tagged | +Inquiry |
| RNF135-501H | Recombinant Human RNF135 protein, His-tagged | +Inquiry |
| RNF135-689H | Recombinant Human RNF135 Protein, MYC/DDK-tagged | +Inquiry |
| RNF135-0411H | Recombinant Human RNF135 Protein (A2-V432), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF135-1519HCL | Recombinant Human RNF135 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF135 Products
Required fields are marked with *
My Review for All RNF135 Products
Required fields are marked with *
