Recombinant Human RNF216 protein, GST-tagged
Cat.No. : | RNF216-3625H |
Product Overview : | Recombinant Human RNF216 protein(73 - 276 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 73 - 276 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RNF216 ring finger protein 216 [ Homo sapiens ] |
Official Symbol | RNF216 |
Synonyms | RNF216; ring finger protein 216; E3 ubiquitin-protein ligase RNF216; TRIAD3; U7I1; UBCE7IP1; ZIN; triad domain-containing protein 3; zinc finger protein inhibiting NF-kappa-B; ubiquitin-conjugating enzyme 7-interacting protein 1; |
Gene ID | 54476 |
mRNA Refseq | NM_207111 |
Protein Refseq | NP_996994 |
MIM | 609948 |
UniProt ID | Q9NWF9 |
◆ Recombinant Proteins | ||
RNF216-3625H | Recombinant Human RNF216 protein, GST-tagged | +Inquiry |
RNF216-0612H | Recombinant Human RNF216 Protein (E2-F866), Tag Free | +Inquiry |
RNF216-7677M | Recombinant Mouse RNF216 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF216-0613H | Recombinant Human RNF216 Protein (E2-F866), His tagged | +Inquiry |
RNF216-14335M | Recombinant Mouse RNF216 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF216-2282HCL | Recombinant Human RNF216 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF216 Products
Required fields are marked with *
My Review for All RNF216 Products
Required fields are marked with *
0
Inquiry Basket