Recombinant Human RORC Protein, GST-tagged

Cat.No. : RORC-114H
Product Overview : Recombinant Human RORC was expressed in insect cells with N-terminal GST tag.
Availability September 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : GST
Form : Liquid
Molecular Mass : ~57 kDa as estimated in SDS-PAGE under reducing conditions.
AA Sequence : YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Purity : > 90% determined by SDS-PAGE
Storage : Immediately store at -80 centigrade. Avoid freeze-thaw cycles. While working, please keep sample on ice.
Storage Buffer : 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 10 mM reduced glutathione, 20% glycerol.
Publications :
Discovery, Synthesis, and In Vitro Characterization of 2,3 Derivatives of 4,5,6,7-Tetrahydro-Benzothiophene as Potent Modulators of Retinoic Acid Receptor-Related Orphan Receptor γt (2023)
Discovery of a novel RORγ antagonist with skin-restricted exposure for topical treatment of mild to moderate psoriasis (2021)
RORγt inverse agonist TF-S14 inhibits Th17 cytokines and prolongs skin allograft survival in sensitized mice (2024)
Gene Name RORC RAR-related orphan receptor C [ Homo sapiens ]
Official Symbol RORC
Synonyms RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
Gene ID 6097
mRNA Refseq NM_001001523
Protein Refseq NP_001001523
MIM 602943
UniProt ID P51449

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RORC Products

Required fields are marked with *

My Review for All RORC Products

Required fields are marked with *

0
cart-icon