Recombinant Human RORC Protein, GST-tagged
| Cat.No. : | RORC-114H |
| Product Overview : | Recombinant Human RORC was expressed in insect cells with N-terminal GST tag. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | GST |
| Form : | Liquid |
| Molecular Mass : | ~57 kDa as estimated in SDS-PAGE under reducing conditions. |
| AA Sequence : | YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK |
| Purity : | > 90% determined by SDS-PAGE |
| Storage : | Immediately store at -80 centigrade. Avoid freeze-thaw cycles. While working, please keep sample on ice. |
| Storage Buffer : | 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 10 mM reduced glutathione, 20% glycerol. |
| Publications : |
Discovery, Synthesis, and In Vitro Characterization of 2,3 Derivatives of 4,5,6,7-Tetrahydro-Benzothiophene as Potent Modulators of Retinoic Acid Receptor-Related Orphan Receptor γt (2023)
Discovery of a novel RORγ antagonist with skin-restricted exposure for topical treatment of mild to moderate psoriasis (2021)
RORγt inverse agonist TF-S14 inhibits Th17 cytokines and prolongs skin allograft survival in sensitized mice (2024)
|
| Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
| Official Symbol | RORC |
| Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539 |
| Gene ID | 6097 |
| mRNA Refseq | NM_001001523 |
| Protein Refseq | NP_001001523 |
| MIM | 602943 |
| UniProt ID | P51449 |
| ◆ Recombinant Proteins | ||
| RORC-1084H | Recombinant Human RORC protein, His-tagged | +Inquiry |
| RORC-02H | Recombinant Human RORC Protein, GST-tagged | +Inquiry |
| RORC-14381M | Recombinant Mouse RORC Protein | +Inquiry |
| RORC-6192H | Recombinant Human RORC Protein (Leu241-Phe486), N-His tagged | +Inquiry |
| RORC-1357H | Recombinant Human RORC Protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
| RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *
