Recombinant Human RORC protein, GST-tagged
Cat.No. : | RORC-18H |
Product Overview : | Recombinant Human RORC partial ORF ( NP_005051.2, 412 a.a. - 517 a.a.) Protein, fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | FSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIF QHLHPIVVQAAFPPLYKELFSTETESPVGLS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
Official Symbol | RORC |
Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539 |
Gene ID | 6097 |
mRNA Refseq | NM_001001523 |
Protein Refseq | NP_001001523 |
MIM | 602943 |
UniProt ID | P51449 |
Chromosome Location | 1q21 |
Pathway | Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene ex |
Function | DNA binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding |
◆ Recombinant Proteins | ||
RORC-631HF | Recombinant Full Length Human RORC Protein, GST-tagged | +Inquiry |
RORC-6192H | Recombinant Human RORC Protein (Leu241-Phe486), N-His tagged | +Inquiry |
RORC-01H | Recombinant Human RAR related orphan receptor C protein, His tagged | +Inquiry |
Rorc-5576M | Recombinant Mouse Rorc Protein, Myc/DDK-tagged | +Inquiry |
Rorc-2027M | Recombinant Mouse Rorc Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *