Recombinant Human RPIA, His-tagged
| Cat.No. : | RPIA-31147TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 32-311 of Human RPIA with N terminal His tag; Predicted MWt 31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 32-311 a.a. |
| Description : | The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 64 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICPA PSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIV HAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLS DLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIV AGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPV SRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFD RVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDG SVNMREKPFC |
| Sequence Similarities : | Belongs to the ribose 5-phosphate isomerase family. |
| Gene Name | RPIA ribose 5-phosphate isomerase A [ Homo sapiens ] |
| Official Symbol | RPIA |
| Synonyms | RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase; |
| Gene ID | 22934 |
| mRNA Refseq | NM_144563 |
| Protein Refseq | NP_653164 |
| MIM | 180430 |
| Uniprot ID | P49247 |
| Chromosome Location | 2p11.2 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Pentose Phosphate Pathway, organism-specific biosystem; Pentose phosphate pathway, organism-specific biosystem; Pentose phosphate pathway, conserved biosystem; |
| Function | isomerase activity; monosaccharide binding; ribose-5-phosphate isomerase activity; |
| ◆ Recombinant Proteins | ||
| RPIA-31148TH | Recombinant Human RPIA, His-tagged | +Inquiry |
| RPIA-1571H | Recombinant Human Ribose 5-Phosphate Isomerase A, His-tagged | +Inquiry |
| RPIA-1684Z | Recombinant Zebrafish RPIA | +Inquiry |
| RPIA-6744H | Recombinant Human RPIA protein, GST-tagged | +Inquiry |
| RPIA-2367E | Recombinant Escherichia coli RPIA Protein (1-219 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPIA-2231HCL | Recombinant Human RPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPIA Products
Required fields are marked with *
My Review for All RPIA Products
Required fields are marked with *
