Recombinant Human RPS7 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPS7-117H |
Product Overview : | RPS7 MS Standard C13 and N15-labeled recombinant protein (NP_001002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQVRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPS7 ribosomal protein S7 [ Homo sapiens (human) ] |
Official Symbol | RPS7 |
Synonyms | RPS7; ribosomal protein S7; DBA8; eS7; S7; 40S ribosomal protein S7; small ribosomal subunit protein eS7; EC 3.6.5.3 |
Gene ID | 6201 |
mRNA Refseq | NM_001011 |
Protein Refseq | NP_001002 |
MIM | 603658 |
UniProt ID | P62081 |
◆ Recombinant Proteins | ||
RPS7-4030R | Recombinant Rhesus monkey RPS7 Protein, His-tagged | +Inquiry |
RPS7-6203H | Recombinant Human RPS7 Protein (Met1-Leu194), C-His tagged | +Inquiry |
RPS7-117H | Recombinant Human RPS7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPS7-4752H | Recombinant Human Ribosomal Protein S7, His-tagged | +Inquiry |
RPS7-6858H | Recombinant Human Ribosomal Protein S7, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS7 Products
Required fields are marked with *
My Review for All RPS7 Products
Required fields are marked with *
0
Inquiry Basket