Recombinant Human RUNX3 protein, His&Myc-tagged
Cat.No. : | RUNX3-3456H |
Product Overview : | Recombinant Human RUNX3 protein(Q13761)(1-415aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-415aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RUNX3 runt-related transcription factor 3 [ Homo sapiens ] |
Official Symbol | RUNX3 |
Synonyms | RUNX3; runt-related transcription factor 3; CBFA3; AML2; PEBP2A3; CBF-alpha-3; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; oncogene AML-2; transcription factor AML2; acute myeloid leukemia gene 2; acute myeloid leukemia 2 protein; core-binding factor subunit alpha-3; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core-binding factor alpha C subunit; core-binding factor, runt domain, alpha subunit 3; polyomavirus enhancer-binding protein 2 alpha C subunit; PEBP2aC; FLJ34510; MGC16070; |
Gene ID | 864 |
mRNA Refseq | NM_001031680 |
Protein Refseq | NP_001026850 |
MIM | 600210 |
UniProt ID | Q13761 |
◆ Recombinant Proteins | ||
RUNX3-7854H | Recombinant Human RUNX3 protein, GST-tagged | +Inquiry |
RUNX3-7855H | Recombinant Human RUNX3 protein, His-tagged | +Inquiry |
RUNX3-31339TH | Recombinant Human RUNX3, His-tagged | +Inquiry |
Runx3-8208M | Recombinant Mouse Runx3 protein, His & T7-tagged | +Inquiry |
RUNX3-2500H | Active Recombinant Human Runt-related Transcription Factor 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX3-2106HCL | Recombinant Human RUNX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RUNX3 Products
Required fields are marked with *
My Review for All RUNX3 Products
Required fields are marked with *