Recombinant Human S100A11 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A11-3444H
Product Overview : S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Molecular Mass : 11.7 kDa
AA Sequence : MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A11 S100 calcium binding protein A11 [ Homo sapiens (human) ]
Official Symbol S100A11
Synonyms S100A11; S100 calcium binding protein A11; S100 calcium binding protein A11 (calgizzarin), S100 calcium binding protein A11 (calgizzarin); protein S100-A11; S100C; MLN 70; calgizzarin; protein S100-C; metastatic lymph node gene 70 protein; S100 calcium-binding protein A11 (calgizzarin); MLN70;
Gene ID 6282
mRNA Refseq NM_005620
Protein Refseq NP_005611
MIM 603114
UniProt ID P31949

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A11 Products

Required fields are marked with *

My Review for All S100A11 Products

Required fields are marked with *

0
cart-icon