Recombinant Human S100A11 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A11-3444H |
Product Overview : | S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A11 S100 calcium binding protein A11 [ Homo sapiens (human) ] |
Official Symbol | S100A11 |
Synonyms | S100A11; S100 calcium binding protein A11; S100 calcium binding protein A11 (calgizzarin), S100 calcium binding protein A11 (calgizzarin); protein S100-A11; S100C; MLN 70; calgizzarin; protein S100-C; metastatic lymph node gene 70 protein; S100 calcium-binding protein A11 (calgizzarin); MLN70; |
Gene ID | 6282 |
mRNA Refseq | NM_005620 |
Protein Refseq | NP_005611 |
MIM | 603114 |
UniProt ID | P31949 |
◆ Recombinant Proteins | ||
S100A11-6224H | Recombinant Human S100A11 Protein (Met1-Thr105), His tagged | +Inquiry |
S100a11-2582R | Recombinant Rat S100a11 protein, His-tagged | +Inquiry |
S100A11-7865M | Recombinant Mouse S100A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100a11-5665M | Recombinant Mouse S100a11 Protein, Myc/DDK-tagged | +Inquiry |
S100A11-2580C | Recombinant Chicken S100A11 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A11-2095HCL | Recombinant Human S100A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A11 Products
Required fields are marked with *
My Review for All S100A11 Products
Required fields are marked with *