Recombinant Human S100A12 protein, GST-tagged
Cat.No. : | S100A12-3460H |
Product Overview : | Recombinant Human S100A12 protein(P80511)(2-92aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-92aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A12 S100 calcium binding protein A12 [ Homo sapiens ] |
Official Symbol | S100A12 |
Synonyms | S100A12; S100 calcium binding protein A12; S100 calcium binding protein A12 (calgranulin C) , S100 calcium binding protein A12 (calgranulin C); protein S100-A12; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; EN-RAGE; calgranulin C; calgranulin-C; neutrophil S100 protein; calcium-binding protein in amniotic fluid 1; S100 calcium-binding protein A12 (calgranulin C); extracellular newly identified RAGE-binding protein; |
Gene ID | 6283 |
mRNA Refseq | NM_005621 |
Protein Refseq | NP_005612 |
MIM | 603112 |
UniProt ID | P80511 |
◆ Recombinant Proteins | ||
S100A12-653HFL | Recombinant Full Length Human S100A12 Protein, C-Flag-tagged | +Inquiry |
S100A12-3721H | Recombinant Human S100A12, His-tagged | +Inquiry |
S100A12-289H | Recombinant Human S100A12 Protein, His-tagged(C-ter) | +Inquiry |
S100A12-33H | Recombinant Human S100A12 protein, Myc/DDK-tagged | +Inquiry |
S100A12-2562H | Active Recombinant Human S100A12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A12-2094HCL | Recombinant Human S100A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A12 Products
Required fields are marked with *
My Review for All S100A12 Products
Required fields are marked with *