Recombinant Human S100A12 protein, GST-tagged
| Cat.No. : | S100A12-3460H |
| Product Overview : | Recombinant Human S100A12 protein(P80511)(2-92aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-92aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.4 kDa |
| AA Sequence : | TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | S100A12 S100 calcium binding protein A12 [ Homo sapiens ] |
| Official Symbol | S100A12 |
| Synonyms | S100A12; S100 calcium binding protein A12; S100 calcium binding protein A12 (calgranulin C) , S100 calcium binding protein A12 (calgranulin C); protein S100-A12; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; EN-RAGE; calgranulin C; calgranulin-C; neutrophil S100 protein; calcium-binding protein in amniotic fluid 1; S100 calcium-binding protein A12 (calgranulin C); extracellular newly identified RAGE-binding protein; |
| Gene ID | 6283 |
| mRNA Refseq | NM_005621 |
| Protein Refseq | NP_005612 |
| MIM | 603112 |
| UniProt ID | P80511 |
| ◆ Recombinant Proteins | ||
| S100A12-215H | Recombinant Human S100A12, Fc-tagged | +Inquiry |
| S100A12-2563H | Active Recombinant Human S100A12 protein, His-tagged | +Inquiry |
| S100A12-1478C | Recombinant Cattle S100A12 protein, His-tagged | +Inquiry |
| S100A12-30229TH | Recombinant Human S100A12, His-tagged | +Inquiry |
| S100A12-204H | Recombinant Human S100A12, Fc-tagged, C13&N15 Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A12-2094HCL | Recombinant Human S100A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A12 Products
Required fields are marked with *
My Review for All S100A12 Products
Required fields are marked with *



