Recombinant Human S100A4 protein, His-SUMO-tagged
| Cat.No. : | S100A4-3461H |
| Product Overview : | Recombinant Human S100A4 protein(P26447)(2-101aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-101aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.6 kDa |
| AA Sequence : | ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | S100A4 S100 calcium binding protein A4 [ Homo sapiens ] |
| Official Symbol | S100A4 |
| Synonyms | S100A4; S100 calcium binding protein A4; CAPL, MTS1, S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) , S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); protein S100-A4; 18A2; 42A; fibroblast specific protein 1; FSP1; P9KA; PEL98; protein Mts1; fibroblast-specific protein-1; placental calcium-binding protein; malignant transformation suppression 1; leukemia multidrug resistance associated protein; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); CAPL; MTS1; |
| Gene ID | 6275 |
| mRNA Refseq | NM_002961 |
| Protein Refseq | NP_002952 |
| MIM | 114210 |
| UniProt ID | P26447 |
| ◆ Recombinant Proteins | ||
| S100A4-3461H | Recombinant Human S100A4 protein, His-SUMO-tagged | +Inquiry |
| S100a4-566M | Recombinant Mouse S100a4 Protein, hFc-tagged | +Inquiry |
| S100A4-159M | Recombinant Mouse S100a4, Fc tagged | +Inquiry |
| S100a4-5105M | Recombinant Mouse S100 calcium Binding Protein A4, His-tagged | +Inquiry |
| S100A4-1455H | Recombinant Human S100A4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
| S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A4 Products
Required fields are marked with *
My Review for All S100A4 Products
Required fields are marked with *



