Recombinant Rhesus S100B protein

Cat.No. : S100B-544R
Product Overview : Recombinant Rhesus S100B protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 91
Description : S100B belongs to the S100 family, which containing 2 EF-hand calcium-binding motifs. In humans, S100B protein is encoded by the S100P gene located at 4q16, but genes that encode other numbers of s100 family proteins are almost located at 1q21 as a cluster. S100B is glial-specific and is expressed primarily by astrocytes. Not all astrocytes express S100B. It has been shown that S100B is only expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. This protein may function in neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. In the developing CNS it acts as a neurotrophic factor and neuronal survival protein.
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Molecular Mass : Approximately 10.6 kDa, a single non-glycosylated polypeptide chain containing 91 amino acids
AA Sequence : SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMVTTACHEFFEHE
Endotoxin : Less than 1 EU/μg of rRhS100B as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name S100B
Official Symbol S100B
Synonyms Protein S100-P, Migration-inducing gene 9 protein, MIG9, Protein S100-E, S100 calcium-binding protein P
Gene ID 708117
mRNA Refseq NM_001260526.1
Protein Refseq NP_001247455.1
UniProt ID F7ANQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100B Products

Required fields are marked with *

My Review for All S100B Products

Required fields are marked with *

0
cart-icon