Recombinant Human SAG protein, GST-tagged

• Cat.No.: SAG-2971H
• Product Overview: Recombinant Human SAG protein(1-113 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-113 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ]
• Official Symbol: SAG
• Synonyms: SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383
• Gene ID: 6295
• mRNA Refseq: NM_000541
• Protein Refseq: NP_000532
• MIM: 181031
• UniProt ID: P10523