Recombinant Human SART3 Protein (600-900 aa), His-SUMO-tagged

Cat.No. : SART3-1016H
Product Overview : Recombinant Human SART3 Protein (600-900 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 600-900 aa
Description : U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassbly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation . Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assbly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites . May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassbly . May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair . May play a role in hatopoiesis probably through transcription regulation of specific genes including MYC.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 49.8 kDa
AA Sequence : QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name SART3 squamous cell carcinoma antigen recognized by T cells 3 [ Homo sapiens ]
Official Symbol SART3
Synonyms SART3; KIAA0156; RP11 13G14; SART-3; hSART-3; P100; p110; DSAP1; TIP110; p110(nrb); RP11-13G14; MGC138188;
Gene ID 9733
mRNA Refseq NM_014706
Protein Refseq NP_055521
MIM 611684
UniProt ID Q15020

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SART3 Products

Required fields are marked with *

My Review for All SART3 Products

Required fields are marked with *

0
cart-icon
0
compare icon