Recombinant Human SDCBP protein, hFc-Flag-tagged

Cat.No. : SDCBP-2634H
Product Overview : Recombinant Human SDCBP protein(O00560)(2-298aa), fused with C-terminal hFc and Flag tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&Flag
Protein Length : 2-298aa
Tag : C-hFc-Flag
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 59.5 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Gene Name SDCBP syndecan binding protein (syntenin) [ Homo sapiens ]
Official Symbol SDCBP
Synonyms SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18;
Gene ID 6386
mRNA Refseq NM_001007067
Protein Refseq NP_001007068
MIM 602217
UniProt ID O00560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDCBP Products

Required fields are marked with *

My Review for All SDCBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon