Recombinant Human SERPINB8 protein, GST-tagged
| Cat.No. : | SERPINB8-2597H |
| Product Overview : | Recombinant Human SERPINB8 protein(1-242 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-242 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SERPINB8 serpin peptidase inhibitor, clade B (ovalbumin), member 8 [ Homo sapiens ] |
| Official Symbol | SERPINB8 |
| Synonyms | SERPINB8; serpin peptidase inhibitor, clade B (ovalbumin), member 8; PI8, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; serpin B8; CAP2; cytoplasmic antiproteinase 2; PI-8; peptidase inhibitor 8; protease inhibitor 8 (ovalbumin type); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; PI8; |
| Gene ID | 5271 |
| mRNA Refseq | NM_001031848 |
| Protein Refseq | NP_001027018 |
| MIM | 601697 |
| UniProt ID | P50452 |
| ◆ Recombinant Proteins | ||
| SERPINB8-686H | Recombinant Human serpin peptidase inhibitor, clade B (ovalbumin), member 8, His-tagged | +Inquiry |
| SERPINB8-2250H | Recombinant Human SERPINB8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SERPINB8-1005H | Recombinant Human SERPINB8 Protein, MYC/DDK-tagged | +Inquiry |
| SERPINB8-31160TH | Recombinant Human SERPINB8 | +Inquiry |
| SERPINB8-2597H | Recombinant Human SERPINB8 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB8-665MCL | Recombinant Mouse SERPINB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB8 Products
Required fields are marked with *
My Review for All SERPINB8 Products
Required fields are marked with *
