Recombinant Human SERPINB8
Cat.No. : | SERPINB8-31160TH |
Product Overview : | Recombinant full length Human SerpinB8 with a N terminal proprietary tag: predicted MW 52.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 242 amino acids |
Description : | The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. |
Molecular Weight : | 52.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALA MVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRT GTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELS FAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLV LVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV KE |
Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
Gene Name | SERPINB8 serpin peptidase inhibitor, clade B (ovalbumin), member 8 [ Homo sapiens ] |
Official Symbol | SERPINB8 |
Synonyms | SERPINB8; serpin peptidase inhibitor, clade B (ovalbumin), member 8; PI8, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; serpin B8; CAP2; cytoplasmic antiproteinase 2; |
Gene ID | 5271 |
mRNA Refseq | NM_001031848 |
Protein Refseq | NP_001027018 |
MIM | 601697 |
Uniprot ID | P50452 |
Chromosome Location | 18q21.3 |
Function | peptidase inhibitor activity; protein binding; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SERPINB8-2250H | Recombinant Human SERPINB8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINB8-465HF | Recombinant Full Length Human SERPINB8 Protein | +Inquiry |
SERPINB8-686H | Recombinant Human serpin peptidase inhibitor, clade B (ovalbumin), member 8, His-tagged | +Inquiry |
SERPINB8-2597H | Recombinant Human SERPINB8, GST-tagged | +Inquiry |
SERPINB8-1005H | Recombinant Human SERPINB8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB8-665MCL | Recombinant Mouse SERPINB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB8 Products
Required fields are marked with *
My Review for All SERPINB8 Products
Required fields are marked with *
0
Inquiry Basket