Recombinant Human SET Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SET-5914H |
Product Overview : | SET MS Standard C13 and N15-labeled recombinant protein (NP_003002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SET SET nuclear oncogene [ Homo sapiens (human) ] |
Official Symbol | SET |
Synonyms | SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor; HLA-DR-associated protein II; phosphatase 2A inhibitor I2PP2A; inhibitor-2 of protein phosphatase-2A; inhibitor of granzyme A-activated DNase; SET translocation (myeloid leukemia-associated); Template-Activating Factor-I, chromatin remodelling factor; IGAAD; TAF-I; I2PP2A; TAF-IBETA; |
Gene ID | 6418 |
mRNA Refseq | NM_003011 |
Protein Refseq | NP_003002 |
MIM | 600960 |
UniProt ID | Q01105 |
◆ Recombinant Proteins | ||
SET-2394C | Recombinant Chicken SET | +Inquiry |
SET-30076TH | Recombinant Human SET | +Inquiry |
SET-5348R | Recombinant Rat SET Protein | +Inquiry |
SET-14976M | Recombinant Mouse SET Protein | +Inquiry |
SET-2047H | Recombinant Human SET Nuclear Oncogene | +Inquiry |
◆ Cell & Tissue Lysates | ||
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SET Products
Required fields are marked with *
My Review for All SET Products
Required fields are marked with *