Recombinant Human SFN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SFN-4511H |
Product Overview : | SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. |
Molecular Mass : | 27.8 kDa |
AA Sequence : | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SFN stratifin [ Homo sapiens (human) ] |
Official Symbol | SFN |
Synonyms | SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS; 14-3-3 sigma; epithelial cell marker protein 1; |
Gene ID | 2810 |
mRNA Refseq | NM_006142 |
Protein Refseq | NP_006133 |
MIM | 601290 |
UniProt ID | P31947 |
◆ Recombinant Proteins | ||
Sfn-697M | Recombinant Mouse Sfn Protein, His-tagged | +Inquiry |
SFN-5538C | Recombinant Chicken SFN | +Inquiry |
SFN-1991H | Recombinant Human SFN Protein, His (Fc)-Avi-tagged | +Inquiry |
SFN-942HFL | Recombinant Full Length Human SFN Protein, C-Flag-tagged | +Inquiry |
SFN-855H | Recombinant Human SFN protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFN-1912HCL | Recombinant Human SFN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFN Products
Required fields are marked with *
My Review for All SFN Products
Required fields are marked with *
0
Inquiry Basket