Recombinant Human SFTPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SFTPA2-4609H
• Product Overview: SFTPA2 MS Standard C13 and N15-labeled recombinant protein (NP_001092138) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
• Molecular Mass: 26 kDa
• AA Sequence: MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SFTPA2 surfactant protein A2 [ Homo sapiens (human) ]
• Official Symbol: SFTPA2
• Synonyms: SFTPA2; surfactant protein A2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B; pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin 5; surfactant, pulmonary-associated protein A2A
• Gene ID: 729238
• mRNA Refseq: NM_001098668
• Protein Refseq: NP_001092138
• MIM: 178642
• UniProt ID: Q8IWL1