Recombinant Human SFTPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SFTPA2-4609H
Product Overview : SFTPA2 MS Standard C13 and N15-labeled recombinant protein (NP_001092138) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
Molecular Mass : 26 kDa
AA Sequence : MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SFTPA2 surfactant protein A2 [ Homo sapiens (human) ]
Official Symbol SFTPA2
Synonyms SFTPA2; surfactant protein A2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B; pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin 5; surfactant, pulmonary-associated protein A2A
Gene ID 729238
mRNA Refseq NM_001098668
Protein Refseq NP_001092138
MIM 178642
UniProt ID Q8IWL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPA2 Products

Required fields are marked with *

My Review for All SFTPA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon