Recombinant Human SFTPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SFTPA2-4609H |
Product Overview : | SFTPA2 MS Standard C13 and N15-labeled recombinant protein (NP_001092138) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. |
Molecular Mass : | 26 kDa |
AA Sequence : | MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SFTPA2 surfactant protein A2 [ Homo sapiens (human) ] |
Official Symbol | SFTPA2 |
Synonyms | SFTPA2; surfactant protein A2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B; pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin 5; surfactant, pulmonary-associated protein A2A |
Gene ID | 729238 |
mRNA Refseq | NM_001098668 |
Protein Refseq | NP_001092138 |
MIM | 178642 |
UniProt ID | Q8IWL1 |
◆ Recombinant Proteins | ||
SFTPA2-15H | Recombinant Human SFTPA2 protein, GST-tagged | +Inquiry |
SFTPA2-3821HFL | Recombinant Full Length Human SFTPA2 protein, Flag-tagged | +Inquiry |
SFTPA2-4609H | Recombinant Human SFTPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SFTPA2-188H | Recombinant Human SFTPA2, His-tagged | +Inquiry |
SFTPA2-691HF | Recombinant Full Length Human SFTPA2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPA2 Products
Required fields are marked with *
My Review for All SFTPA2 Products
Required fields are marked with *