Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged

Cat.No. : SFTPB-2810H
Product Overview : Recombinant Human SFTPB Protein (201-279 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : MBP
Protein Length : 201-279 aa
Description : Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 50.7 kDa
AA Sequence : FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SFTPB surfactant protein B [ Homo sapiens ]
Official Symbol SFTPB
Synonyms SFTPB; surfactant protein B; SP B; 6 kDa protein; SP-B; PSP-B; SFTB3; SFTP3; SMDP1;
Gene ID 6439
mRNA Refseq NM_000542
Protein Refseq NP_000533
MIM 178640
UniProt ID P07988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPB Products

Required fields are marked with *

My Review for All SFTPB Products

Required fields are marked with *

0
cart-icon
0
compare icon