Recombinant Human SHANK3 protein, His-tagged

• Cat.No.: SHANK3-32H
• Product Overview: Recombinant Human SHANK3 protein(Q9BYB0)(671-750 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 671-750 aa
• Form: Phosphate buffered saline
• Molecular Mass: 10 kDa
• AASequence: DGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRIT
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SHANK3 SH3 and multiple ankyrin repeat domains 3 [ Homo sapiens ]
• Official Symbol: SHANK3
• Synonyms: SHANK3; SH3 and multiple ankyrin repeat domains 3; SH3 and multiple ankyrin repeat domains protein 3; KIAA1650; proline rich synapse associated protein 2; prosap2; PSAP2; shank postsynaptic density protein; SPANK 2; SCZD15; PROSAP2; SPANK-2; DEL22q13.3
• Gene ID: 85358
• mRNA Refseq: NM_033517
• Protein Refseq: NP_277052
• MIM: 606230
• UniProt ID: Q9BYB0