Recombinant Human SHANK3 protein, His-tagged
Cat.No. : | SHANK3-32H |
Product Overview : | Recombinant Human SHANK3 protein(Q9BYB0)(671-750 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 671-750 aa |
Form : | Phosphate buffered saline |
Molecular Mass : | 10 kDa |
AASequence : | DGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRIT |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SHANK3 SH3 and multiple ankyrin repeat domains 3 [ Homo sapiens ] |
Official Symbol | SHANK3 |
Synonyms | SHANK3; SH3 and multiple ankyrin repeat domains 3; SH3 and multiple ankyrin repeat domains protein 3; KIAA1650; proline rich synapse associated protein 2; prosap2; PSAP2; shank postsynaptic density protein; SPANK 2; SCZD15; PROSAP2; SPANK-2; DEL22q13.3; |
Gene ID | 85358 |
mRNA Refseq | NM_033517 |
Protein Refseq | NP_277052 |
MIM | 606230 |
UniProt ID | Q9BYB0 |
◆ Recombinant Proteins | ||
Shank3-5852M | Recombinant Mouse Shank3 Protein, Myc/DDK-tagged | +Inquiry |
SHANK3-12M | Recombinant Mouse SHANK3 Protein | +Inquiry |
SHANK3-5046R | Recombinant Rat SHANK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHANK3-15086M | Recombinant Mouse SHANK3 Protein | +Inquiry |
SHANK3-301390H | Recombinant Human SHANK3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SHANK3-10H | Recombinant Human SHANK3 Protein, His&ABP tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHANK3 Products
Required fields are marked with *
My Review for All SHANK3 Products
Required fields are marked with *