Recombinant Human SHANK3 protein, His-tagged
| Cat.No. : | SHANK3-32H |
| Product Overview : | Recombinant Human SHANK3 protein(Q9BYB0)(671-750 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 671-750 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 10 kDa |
| AASequence : | DGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRIT |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SHANK3 SH3 and multiple ankyrin repeat domains 3 [ Homo sapiens ] |
| Official Symbol | SHANK3 |
| Synonyms | SHANK3; SH3 and multiple ankyrin repeat domains 3; SH3 and multiple ankyrin repeat domains protein 3; KIAA1650; proline rich synapse associated protein 2; prosap2; PSAP2; shank postsynaptic density protein; SPANK 2; SCZD15; PROSAP2; SPANK-2; DEL22q13.3; |
| Gene ID | 85358 |
| mRNA Refseq | NM_033517 |
| Protein Refseq | NP_277052 |
| MIM | 606230 |
| UniProt ID | Q9BYB0 |
| ◆ Recombinant Proteins | ||
| SHANK3-301390H | Recombinant Human SHANK3 protein, GST-tagged | +Inquiry |
| SHANK3-5046R | Recombinant Rat SHANK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SHANK3-5387R | Recombinant Rat SHANK3 Protein | +Inquiry |
| SHANK3-32H | Recombinant Human SHANK3 protein, His-tagged | +Inquiry |
| Shank3-5852M | Recombinant Mouse Shank3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHANK3 Products
Required fields are marked with *
My Review for All SHANK3 Products
Required fields are marked with *
