Recombinant Human SIGLEC6 Protein, His-tagged
Cat.No. : | SIGLEC6-191H |
Product Overview : | Recombinant Human SIGLEC6 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Two families of mammalian lectin-like adhesion molecules, the selectins and the sialoadhesins, bind glycoconjugate ligands in a sialic acid-dependent manner. The sialic acid-binding immunoglobulin superfamily lectins, designated Siglecs or sialoadhesins, recognize sialylated ligands and play a key role in mediating sialic-acid dependent binding to cells. Siglec-6, also called obesitybinding protein 1, is an adhesion molecule that is highly expressed in placental trophoblasts, as well as in peripheral blood leukocytes. Siglec-6 can bind both N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc), the two common sialic acids found in mammalian cells. Together with the other members of the Siglec family, Siglec-6 promotes cell-cell interactions and plays a roll in the innate and adaptive immune systems through glycan recognition. |
Molecular Mass : | ~35 kDa |
AA Sequence : | QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens (human) ] |
Official Symbol | SIGLEC6 |
Synonyms | SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327; |
Gene ID | 946 |
mRNA Refseq | NM_001177547 |
Protein Refseq | NP_001171018 |
MIM | 604405 |
UniProt ID | O43699 |
◆ Recombinant Proteins | ||
SIGLEC6-1743R | Recombinant Rhesus Monkey SIGLEC6 Protein | +Inquiry |
SIGLEC6-559H | Recombinant Human SIGLEC6 protein, His-Avi-tagged | +Inquiry |
RFL6654HF | Recombinant Full Length Human Sialic Acid-Binding Ig-Like Lectin 6(Siglec6) Protein, His-Tagged | +Inquiry |
SIGLEC6-0687H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
SIGLEC6-191H | Recombinant Human SIGLEC6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC6-795HCL | Recombinant Human SIGLEC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIGLEC6 Products
Required fields are marked with *
My Review for All SIGLEC6 Products
Required fields are marked with *
0
Inquiry Basket