Recombinant Human SIRT3 protein, GST-tagged

Cat.No. : SIRT3-2681H
Product Overview : Recombinant Human SIRT3 protein(202-399 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability October 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 202-399 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SIRT3
Synonyms SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; sir2-like 3; sirtuin type 3; SIR2-like protein 3; silent mating type information regulation 2, S.cerevisiae, homolog 3; mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase;
Gene ID 23410
mRNA Refseq NM_001017524
Protein Refseq NP_001017524
MIM 604481
UniProt ID Q9NTG7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRT3 Products

Required fields are marked with *

My Review for All SIRT3 Products

Required fields are marked with *

0
cart-icon
0
compare icon