Recombinant Human SIRT3 protein, GST-tagged
| Cat.No. : | SIRT3-2681H |
| Product Overview : | Recombinant Human SIRT3 protein(202-399 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 202-399 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | SIRT3 |
| Synonyms | SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; sir2-like 3; sirtuin type 3; SIR2-like protein 3; silent mating type information regulation 2, S.cerevisiae, homolog 3; mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase; |
| Gene ID | 23410 |
| mRNA Refseq | NM_001017524 |
| Protein Refseq | NP_001017524 |
| MIM | 604481 |
| UniProt ID | Q9NTG7 |
| ◆ Recombinant Proteins | ||
| SIRT3-2681H | Recombinant Human SIRT3 protein, GST-tagged | +Inquiry |
| SIRT3-28H | Recombinant Human SIRT3 Protein, His-tagged | +Inquiry |
| Sirt3-1376R | Recombinant Rat Sirt3 protein, His-tagged | +Inquiry |
| SIRT3-4878H | Recombinant Human Sirtuin 3, GST-tagged | +Inquiry |
| SIRT3-345H | Active Recombinant Human SIRT3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIRT3-1833HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
| SIRT3-1832HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT3 Products
Required fields are marked with *
My Review for All SIRT3 Products
Required fields are marked with *



