Recombinant Human SIRT3 protein, His-tagged
Cat.No. : | SIRT3-7843H |
Product Overview : | Recombinant Human SIRT3 protein(202-399 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 202-399 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SIRT3 |
Synonyms | SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; sir2-like 3; sirtuin type 3; SIR2-like protein 3; silent mating type information regulation 2, S.cerevisiae, homolog 3; mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase; |
Gene ID | 23410 |
mRNA Refseq | NM_001017524 |
Protein Refseq | NP_001017524 |
MIM | 604481 |
UniProt ID | Q9NTG7 |
◆ Recombinant Proteins | ||
SIRT3-5033Z | Recombinant Zebrafish SIRT3 | +Inquiry |
Sirt3-1375M | Recombinant Mouse Sirt3 protein, His-tagged | +Inquiry |
SIRT3-2681H | Recombinant Human SIRT3 protein, GST-tagged | +Inquiry |
SIRT3-4060H | Recombinant Human SIRT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIRT3-341H | Active Recombinant Human SIRT3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT3-1833HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
SIRT3-1832HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT3 Products
Required fields are marked with *
My Review for All SIRT3 Products
Required fields are marked with *