Recombinant Human SLAMF7 protein, His-tagged
Cat.No. : | SLAMF7-3633H |
Product Overview : | Recombinant Human SLAMF7 protein(23-227 aa), fused to His tag, was expressed in E. coli. |
Availability | September 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-227 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens ] |
Official Symbol | SLAMF7 |
Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
Gene ID | 57823 |
mRNA Refseq | NM_021181 |
Protein Refseq | NP_067004 |
MIM | 606625 |
UniProt ID | Q9NQ25 |
◆ Recombinant Proteins | ||
SLAMF7-6102H | Recombinant Human SLAMF7 Protein (Ser23-Ser225), C-His tagged | +Inquiry |
SLAMF7-2693H | Recombinant Human SLAMF7, GST-tagged | +Inquiry |
SLAMF7-699HF | Recombinant Full Length Human SLAMF7 Protein | +Inquiry |
SLAMF7-1726R | Recombinant Rhesus Monkey SLAMF7 Protein, hIgG1-tagged | +Inquiry |
SLAMF7-2688H | Active Recombinant Human SLAMF7 protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *