Recombinant Human SLAMF7 protein, His-tagged
| Cat.No. : | SLAMF7-3633H |
| Product Overview : | Recombinant Human SLAMF7 protein(23-227 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-227 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens ] |
| Official Symbol | SLAMF7 |
| Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
| Gene ID | 57823 |
| mRNA Refseq | NM_021181 |
| Protein Refseq | NP_067004 |
| MIM | 606625 |
| UniProt ID | Q9NQ25 |
| ◆ Recombinant Proteins | ||
| SLAMF7-688H | Active Recombinant Human SLAMF7, Fc-tagged, Biotinylated | +Inquiry |
| SLAMF7-294H | Recombinant Human SLAMF7 Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
| SLAMF7-4670H | Active Recombinant Human SLAMF7 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
| SLAMF7-1727R | Recombinant Rhesus Monkey SLAMF7 Protein, hIgG4-tagged | +Inquiry |
| SLAMF7-2499H | Recombinant Human SLAMF7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
| SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *
