Recombinant Human SLC22A1 protein, His-SUMO-tagged
Cat.No. : | SLC22A1-8544H |
Product Overview : | Recombinant Human SLC22A1 protein(O15245)(43-149aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 43-149aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD |
Gene Name | SLC22A1 solute carrier family 22 (organic cation transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC22A1 |
Synonyms | SLC22A1; solute carrier family 22 (organic cation transporter), member 1; solute carrier family 22 member 1; OCT1; organic cation transporter 1; HOCT1; oct1_cds; |
Gene ID | 6580 |
mRNA Refseq | NM_003057 |
Protein Refseq | NP_003048 |
MIM | 602607 |
UniProt ID | O15245 |
◆ Recombinant Proteins | ||
SLC22A1-8255M | Recombinant Mouse SLC22A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC22A1-5110R | Recombinant Rat SLC22A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC22A1-8544H | Recombinant Human SLC22A1 protein, His-SUMO-tagged | +Inquiry |
SLC22A1-15261M | Recombinant Mouse SLC22A1 Protein | +Inquiry |
SLC22A1-5451R | Recombinant Rat SLC22A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A1 Products
Required fields are marked with *
My Review for All SLC22A1 Products
Required fields are marked with *