Recombinant Human SLC25A3
Cat.No. : | SLC25A3-31414TH |
Product Overview : | Recombinant full length Human SLC25A3 with N terminal proprietary tag; Predicted MWt 65.45 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 361 amino acids |
Description : | The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. |
Molecular Weight : | 65.450kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQP RRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHT AVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK GWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWR TSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLR DAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERT VEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVS HPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIM IGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLT Q |
Sequence Similarities : | Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats. |
Gene Name | SLC25A3 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 [ Homo sapiens ] |
Official Symbol | SLC25A3 |
Synonyms | SLC25A3; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3; PHC; phosphate carrier protein, mitochondrial; |
Gene ID | 5250 |
mRNA Refseq | NM_002635 |
Protein Refseq | NP_002626 |
MIM | 600370 |
Uniprot ID | Q00325 |
Chromosome Location | 12q23 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; |
Function | phosphate ion carrier activity; symporter activity; |
◆ Recombinant Proteins | ||
SLC25A3-2723H | Recombinant Human SLC25A3, His-tagged | +Inquiry |
SLC25A3-15316M | Recombinant Mouse SLC25A3 Protein | +Inquiry |
SLC25A3-4252R | Recombinant Rhesus monkey SLC25A3 Protein, His-tagged | +Inquiry |
SLC25A3-31414TH | Recombinant Human SLC25A3 | +Inquiry |
RFL30649PF | Recombinant Full Length Pongo Abelii Phosphate Carrier Protein, Mitochondrial(Slc25A3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1771HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1770HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A3 Products
Required fields are marked with *
My Review for All SLC25A3 Products
Required fields are marked with *