Recombinant Human SLC5A2

• Cat.No.: SLC5A2-30972TH
• Product Overview: Recombinant fragment of Human SGLT2 with a N terminal proprietary tag: predicted molecular weight 31.13 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 50 amino acids
• Description: This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria.
• Molecular Weight: 31.130kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
• Sequence Similarities: Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

Gene Information

• Gene Name: SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC5A2
• Synonyms: SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2
• Gene ID: 6524
• mRNA Refseq: NM_003041
• Protein Refseq: NP_003032
• MIM: 182381
• Uniprot ID: P31639
• Chromosome Location: 16p12-p11
• Pathway: Na+-dependent glucose transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem
• Function: low-affinity glucose:sodium symporter activity; symporter activity; transporter activity