Recombinant Human SLC5A2
| Cat.No. : | SLC5A2-30972TH |
| Product Overview : | Recombinant fragment of Human SGLT2 with a N terminal proprietary tag: predicted molecular weight 31.13 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 50 amino acids |
| Description : | This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. |
| Molecular Weight : | 31.130kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP |
| Sequence Similarities : | Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| Gene Name | SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ] |
| Official Symbol | SLC5A2 |
| Synonyms | SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2; |
| Gene ID | 6524 |
| mRNA Refseq | NM_003041 |
| Protein Refseq | NP_003032 |
| MIM | 182381 |
| Uniprot ID | P31639 |
| Chromosome Location | 16p12-p11 |
| Pathway | Na+-dependent glucose transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem; |
| Function | low-affinity glucose:sodium symporter activity; symporter activity; transporter activity; |
| ◆ Recombinant Proteins | ||
| SLC5A2-12179Z | Recombinant Zebrafish SLC5A2 | +Inquiry |
| SLC5A2-8399M | Recombinant Mouse SLC5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC5A2-6306H | Recombinant Human SLC5A2 Protein (Ser335-Leu423), C-His tagged | +Inquiry |
| SLC5A2-2210H | Recombinant Human SLC5A2 Protein (1-102 aa), His-Myc-tagged | +Inquiry |
| Slc5a2-2078R | Recombinant Rat Slc5a2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC5A2-1709HCL | Recombinant Human SLC5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC5A2 Products
Required fields are marked with *
My Review for All SLC5A2 Products
Required fields are marked with *
