Recombinant Human SLC5A2 Transmembrane protein, His-SUMO & Myc-tagged
Cat.No. : | SLC5A2-2396H |
Product Overview : | Recombinant Human SLC5A2 protein(P31639)(1-102aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-102aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5kDa |
AA Sequence : | MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC5A2 |
Synonyms | SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; solute carrier family 5 member 2; low affinity sodium-glucose cotransporter; solute carrier family 5 (sodium/glucose transporter), member 2; |
Gene ID | 6524 |
mRNA Refseq | NM_003041 |
Protein Refseq | NP_003032 |
MIM | 182381 |
UniProt ID | P31639 |
◆ Recombinant Proteins | ||
SLC5A2-15482M | Recombinant Mouse SLC5A2 Protein | +Inquiry |
SLC5A2-2396H | Recombinant Human SLC5A2 Transmembrane protein, His-SUMO & Myc-tagged | +Inquiry |
SLC5A2-12179Z | Recombinant Zebrafish SLC5A2 | +Inquiry |
SLC5A2-8399M | Recombinant Mouse SLC5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc5a2-2078R | Recombinant Rat Slc5a2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC5A2-1709HCL | Recombinant Human SLC5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC5A2 Products
Required fields are marked with *
My Review for All SLC5A2 Products
Required fields are marked with *