Recombinant Human SLC5A2 Transmembrane protein, His-SUMO & Myc-tagged

• Cat.No.: SLC5A2-2396H
• Product Overview: Recombinant Human SLC5A2 protein(P31639)(1-102aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 1-102aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.5kDa
• AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLC5A2 solute carrier family 5 (sodium/glucose cotransporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC5A2
• Synonyms: SLC5A2; solute carrier family 5 (sodium/glucose cotransporter), member 2; SGLT2; sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; solute carrier family 5 member 2; low affinity sodium-glucose cotransporter; solute carrier family 5 (sodium/glucose transporter), member 2
• Gene ID: 6524
• mRNA Refseq: NM_003041
• Protein Refseq: NP_003032
• MIM: 182381
• UniProt ID: P31639