Recombinant Human SLC6A5 protein, GST-tagged
| Cat.No. : | SLC6A5-6733H |
| Product Overview : | Recombinant Human SLC6A5 protein(1-200 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-200 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPSLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ] |
| Official Symbol | SLC6A5 |
| Synonyms | SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2; |
| Gene ID | 9152 |
| mRNA Refseq | NM_004211 |
| Protein Refseq | NP_004202 |
| MIM | 604159 |
| UniProt ID | Q9Y345 |
| ◆ Recombinant Proteins | ||
| SLC6A5-118H | Recombinant Human SLC6A5 protein, GST-tagged | +Inquiry |
| SLC6A5-1207H | Recombinant Human SLC6A5 Protein (D2-C797), 8×His-Strep, Flag tagged | +Inquiry |
| SLC6A5-683H | Recombinant Human SLC6A5 | +Inquiry |
| SLC6A5-2951H | Recombinant Human SLC6A5 protein, His-tagged | +Inquiry |
| SLC6A5-1947Z | Recombinant Zebrafish SLC6A5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC6A5-1704HCL | Recombinant Human SLC6A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A5 Products
Required fields are marked with *
My Review for All SLC6A5 Products
Required fields are marked with *



