"SLC6A5" Related Products

Recombinant Human SLC6A5 protein, GST-tagged

Cat.No.: SLC6A5-118H
Product Overview: Recombinant Human SLC6A5(294 a.a. - 393 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFV SGSEEYFKYFVLKISAGIEYPGEIR
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ]
Official Symbol: SLC6A5
Synonyms: SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2;
Gene ID: 9152
mRNA Refseq: NM_004211
Protein Refseq: NP_004202
MIM: 604159
UniProt ID: Q9Y345
Chromosome Location: 11p15.1
Pathway: Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function: glycine:sodium symporter activity; neurotransmitter:sodium symporter activity; symporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.