Recombinant Human SLC6A5 protein, GST-tagged

Cat.No. : SLC6A5-118H
Product Overview : Recombinant Human SLC6A5(294 a.a. - 393 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 294-393 a.a.
Description : This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFV SGSEEYFKYFVLKISAGIEYPGEIR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ]
Official Symbol SLC6A5
Synonyms SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2;
Gene ID 9152
mRNA Refseq NM_004211
Protein Refseq NP_004202
MIM 604159
UniProt ID Q9Y345
Chromosome Location 11p15.1
Pathway Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;
Function glycine:sodium symporter activity; neurotransmitter:sodium symporter activity; symporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC6A5 Products

Required fields are marked with *

My Review for All SLC6A5 Products

Required fields are marked with *

0
cart-icon
0
compare icon