Recombinant Human SLC6A5 protein, GST-tagged
Cat.No. : | SLC6A5-118H |
Product Overview : | Recombinant Human SLC6A5(294 a.a. - 393 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 294-393 a.a. |
Description : | This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFV SGSEEYFKYFVLKISAGIEYPGEIR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ] |
Official Symbol | SLC6A5 |
Synonyms | SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2; |
Gene ID | 9152 |
mRNA Refseq | NM_004211 |
Protein Refseq | NP_004202 |
MIM | 604159 |
UniProt ID | Q9Y345 |
Chromosome Location | 11p15.1 |
Pathway | Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem; |
Function | glycine:sodium symporter activity; neurotransmitter:sodium symporter activity; symporter activity; |
◆ Recombinant Proteins | ||
SLC6A5-2951H | Recombinant Human SLC6A5 protein, His-tagged | +Inquiry |
SLC6A5-1207H | Recombinant Human SLC6A5 Protein (D2-C797), 8×His-Strep, Flag tagged | +Inquiry |
SLC6A5-1947Z | Recombinant Zebrafish SLC6A5 | +Inquiry |
SLC6A5-683H | Recombinant Human SLC6A5 | +Inquiry |
SLC6A5-4083H | Recombinant Human SLC6A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A5-1704HCL | Recombinant Human SLC6A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A5 Products
Required fields are marked with *
My Review for All SLC6A5 Products
Required fields are marked with *
0
Inquiry Basket