Recombinant Human SMAD2 protein, T7/His-tagged
| Cat.No. : | SMAD2-118H |
| Product Overview : | Recombinant human SMAD2 fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKS LVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKG LPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYT HSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPA FWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFA ECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGW GAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for human SMAD2 functional regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | SMAD2 SMAD family member 2 [ Homo sapiens ] |
| Official Symbol | SMAD2 |
| Synonyms | SMAD2; SMAD family member 2; MAD, mothers against decapentaplegic homolog 2 (Drosophila) , MADH2, SMAD, mothers against DPP homolog 2 (Drosophila) |
| Gene ID | 4087 |
| mRNA Refseq | NM_001003652 |
| Protein Refseq | NP_001003652 |
| MIM | 601366 |
| UniProt ID | Q15796 |
| Chromosome Location | 18q21 |
| Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
| Function | contributes_to DNA binding; I-SMAD binding; R-SMAD binding; SMAD binding; activating transcription factor binding; chromatin binding; co-SMAD binding; double-stranded DNA binding; phosphatase binding; protein binding; sequence-specific DNA binding transcription factor activity; contributes_to sequence-specific DNA binding transcription factor activity; transcription factor binding; transforming growth factor beta receptor binding; transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity; type I transforming growth factor beta receptor binding; ubiquitin protein ligase binding; |
| ◆ Recombinant Proteins | ||
| SMAD2-901M | Recombinant Mouse SMAD2 Protein, GST & His-tagged | +Inquiry |
| SMAD2-4146R | Recombinant Rhesus Macaque SMAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Smad2-5950M | Recombinant Mouse Smad2 Protein, Myc/DDK-tagged | +Inquiry |
| SMAD2-392H | Recombinant Human SMAD Family Member 2, His-tagged | +Inquiry |
| SMAD2-294H | Recombinant Human SMAD2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMAD2-492HKCL | Human SMAD2 Knockdown Cell Lysate | +Inquiry |
| SMAD2-001MCL | Recombinant Mouse SMAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD2 Products
Required fields are marked with *
My Review for All SMAD2 Products
Required fields are marked with *
