Recombinant Human SMAD2 protein, T7/His-tagged

Cat.No. : SMAD2-118H
Product Overview : Recombinant human SMAD2 fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKS LVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKG LPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYT HSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPA FWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFA ECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGW GAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for human SMAD2 functional regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name SMAD2 SMAD family member 2 [ Homo sapiens ]
Official Symbol SMAD2
Synonyms SMAD2; SMAD family member 2; MAD, mothers against decapentaplegic homolog 2 (Drosophila) , MADH2, SMAD, mothers against DPP homolog 2 (Drosophila)
Gene ID 4087
mRNA Refseq NM_001003652
Protein Refseq NP_001003652
MIM 601366
UniProt ID Q15796
Chromosome Location 18q21
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function contributes_to DNA binding; I-SMAD binding; R-SMAD binding; SMAD binding; activating transcription factor binding; chromatin binding; co-SMAD binding; double-stranded DNA binding; phosphatase binding; protein binding; sequence-specific DNA binding transcription factor activity; contributes_to sequence-specific DNA binding transcription factor activity; transcription factor binding; transforming growth factor beta receptor binding; transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity; type I transforming growth factor beta receptor binding; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMAD2 Products

Required fields are marked with *

My Review for All SMAD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon