Recombinant Human SMAD2 protein, T7/His-tagged

• Cat.No.: SMAD2-118H
• Product Overview: Recombinant human SMAD2 fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKS LVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKG LPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYT HSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPA FWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFA ECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGW GAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for human SMAD2 functional regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: SMAD2 SMAD family member 2 [ Homo sapiens ]
• Official Symbol: SMAD2
• Synonyms: SMAD2; SMAD family member 2; MAD, mothers against decapentaplegic homolog 2 (Drosophila) , MADH2, SMAD, mothers against DPP homolog 2 (Drosophila)
• Gene ID: 4087
• mRNA Refseq: NM_001003652
• Protein Refseq: NP_001003652
• MIM: 601366
• UniProt ID: Q15796
• Chromosome Location: 18q21
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem
• Function: contributes_to DNA binding; I-SMAD binding; R-SMAD binding; SMAD binding; activating transcription factor binding; chromatin binding; co-SMAD binding; double-stranded DNA binding; phosphatase binding; protein binding; sequence-specific DNA binding transcription factor activity; contributes_to sequence-specific DNA binding transcription factor activity; transcription factor binding; transforming growth factor beta receptor binding; transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity; type I transforming growth factor beta receptor binding; ubiquitin protein ligase binding