Recombinant Human SMAD3 protein, His-SUMO-tagged

• Cat.No.: SMAD3-3506H
• Product Overview: Recombinant Human SMAD3 protein(P84022)(1-425aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-425aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.1 kDa
• AA Sequence: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SMAD3 SMAD family member 3 [ Homo sapiens ]
• Official Symbol: SMAD3
• Synonyms: SMAD3; SMAD family member 3; MAD, mothers against decapentaplegic homolog 3 (Drosophila) , MADH3, SMAD, mothers against DPP homolog 3 (Drosophila); mothers against decapentaplegic homolog 3; HsT17436; JV15 2; mad3; hMAD-3; hSMAD3; MAD homolog 3; mad homolog JV15-2; mad protein homolog; mothers against DPP homolog 3; SMA- and MAD-related protein 3; SMAD, mothers against DPP homolog 3; MAD, mothers against decapentaplegic homolog 3; LDS1C; MADH3; JV15-2; HSPC193; MGC60396; DKFZp586N0721; DKFZp686J10186
• Gene ID: 4088
• mRNA Refseq: NM_001145102
• Protein Refseq: NP_001138574
• MIM: 603109
• UniProt ID: P84022