Recombinant Human SMAD3 protein, His-SUMO-tagged
Cat.No. : | SMAD3-3506H |
Product Overview : | Recombinant Human SMAD3 protein(P84022)(1-425aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-425aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.1 kDa |
AA Sequence : | MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SMAD3 SMAD family member 3 [ Homo sapiens ] |
Official Symbol | SMAD3 |
Synonyms | SMAD3; SMAD family member 3; MAD, mothers against decapentaplegic homolog 3 (Drosophila) , MADH3, SMAD, mothers against DPP homolog 3 (Drosophila); mothers against decapentaplegic homolog 3; HsT17436; JV15 2; mad3; hMAD-3; hSMAD3; MAD homolog 3; mad homolog JV15-2; mad protein homolog; mothers against DPP homolog 3; SMA- and MAD-related protein 3; SMAD, mothers against DPP homolog 3; MAD, mothers against decapentaplegic homolog 3; LDS1C; MADH3; JV15-2; HSPC193; MGC60396; DKFZp586N0721; DKFZp686J10186; |
Gene ID | 4088 |
mRNA Refseq | NM_001145102 |
Protein Refseq | NP_001138574 |
MIM | 603109 |
UniProt ID | P84022 |
◆ Recombinant Proteins | ||
SMAD3-3506H | Recombinant Human SMAD3 protein, His-SUMO-tagged | +Inquiry |
SMAD3-326H | Recombinant Human SMAD3 protein, His/MBP-tagged | +Inquiry |
Smad3-0256H | Recombinant Human/Mouse/Rat Smad3 protein, His&GST-tagged | +Inquiry |
SMAD3-1918H | Recombinant Human SMAD3 Protein, MYC/DDK-tagged | +Inquiry |
SMAD3-4788H | Recombinant Human SMAD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMAD3-001MCL | Recombinant Mouse SMAD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD3 Products
Required fields are marked with *
My Review for All SMAD3 Products
Required fields are marked with *