Recombinant Human SMAD7 protein, His-tagged
| Cat.No. : | SMAD7-561H |
| Product Overview : | Recombinant Human SMAD7 protein(NP_001177750)(1-426 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-426 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SMAD7 SMAD family member 7 [ Homo sapiens ] |
| Official Symbol | SMAD7 |
| Synonyms | SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7; hSMAD7; MAD homolog 8; mothers against DPP homolog 8; SMAD, mothers against DPP homolog 7; Mothers against decapentaplegic, drosophila, homolog of, 7; MAD (mothers against decapentaplegic, Drosophila) homolog 7; CRCS3; MADH7; MADH8; FLJ16482; |
| Gene ID | 4092 |
| mRNA Refseq | NM_001190821 |
| Protein Refseq | NP_001177750 |
| MIM | 602932 |
| UniProt ID | O15105 |
| ◆ Recombinant Proteins | ||
| SMAD7-29105TH | Recombinant Human SMAD7 | +Inquiry |
| SMAD7-5269R | Recombinant Rat SMAD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Smad7-5954M | Recombinant Mouse Smad7 Protein, Myc/DDK-tagged | +Inquiry |
| SMAD7-2705H | Recombinant Human SMAD7 Protein, His-tagged | +Inquiry |
| SMAD7-1912H | Recombinant Human SMAD7 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD7 Products
Required fields are marked with *
My Review for All SMAD7 Products
Required fields are marked with *
