Recombinant Human SNX1 protein, GST-tagged
| Cat.No. : | SNX1-3623H |
| Product Overview : | Recombinant Human SNX1 protein(81-287 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 11, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 81-287 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | QDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SNX1 sorting nexin 1 [ Homo sapiens ] |
| Official Symbol | SNX1 |
| Synonyms | SNX1; sorting nexin 1; sorting nexin-1; HsT17379; MGC8664; SNX1A; Vps5; sorting nexin 1A; VPS5; |
| Gene ID | 6642 |
| mRNA Refseq | NM_001242933 |
| Protein Refseq | NP_001229862 |
| MIM | 601272 |
| UniProt ID | Q13596 |
| ◆ Recombinant Proteins | ||
| SNX1-3623H | Recombinant Human SNX1 protein, GST-tagged | +Inquiry |
| SNX1-800H | Recombinant Human SNX1 protein, His-tagged | +Inquiry |
| Snx1-6019M | Recombinant Mouse Snx1 Protein, Myc/DDK-tagged | +Inquiry |
| SNX1-2800H | Recombinant Human Sorting Nexin 1, His-tagged | +Inquiry |
| SNX1-5311R | Recombinant Rat SNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNX1-431HKCL | Human SNX1 Knockdown Cell Lysate | +Inquiry |
| SNX1-1605HCL | Recombinant Human SNX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX1 Products
Required fields are marked with *
My Review for All SNX1 Products
Required fields are marked with *
