Recombinant Human SNX9 protein, His-tagged
Cat.No. : | SNX9-3536H |
Product Overview : | Recombinant Human SNX9 protein(1-362 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-362 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNX9 sorting nexin 9 [ Homo sapiens ] |
Official Symbol | SNX9 |
Synonyms | SNX9; sorting nexin 9; sorting nexin-9; SDP1; SH3PX1; SH3PXD3A; SH3 and PX domain-containing protein 1; SH3 and PX domain-containing protein 3A; SH3 and PX domain-containing protein SH3PX1; Wiskott-Aldrich syndrome protein (WASP) interactor protein; WISP; MST155; MSTP155; |
Gene ID | 51429 |
mRNA Refseq | NM_016224 |
Protein Refseq | NP_057308 |
MIM | 605952 |
UniProt ID | Q9Y5X1 |
◆ Recombinant Proteins | ||
SNX9-3536H | Recombinant Human SNX9 protein, His-tagged | +Inquiry |
SNX9-5901H | Recombinant Human SNX9 Protein (Phe250-Met595), N-His tagged | +Inquiry |
Snx9-6039M | Recombinant Mouse Snx9 Protein, Myc/DDK-tagged | +Inquiry |
SNX9-2066H | Recombinant Human SNX9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX9-536HFL | Recombinant Full Length Human SNX9 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX9-1584HCL | Recombinant Human SNX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX9 Products
Required fields are marked with *
My Review for All SNX9 Products
Required fields are marked with *