Recombinant Human SORT1 protein, GST-tagged

Cat.No. : SORT1-29618TH
Product Overview : Recombinant Human SORT1(203 a.a. - 299 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 203-299 a.a.
Description : This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.41 kDa
AA Sequence : FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SORT1 sortilin 1 [ Homo sapiens ]
Official Symbol SORT1
Synonyms SORT1; sortilin 1; sortilin; Gp95; NT3; NTR3; glycoprotein 95; 100 kDa NT receptor; neurotensin receptor 3; LDLCQ6;
Gene ID 6272
mRNA Refseq NM_002959
Protein Refseq NP_002950
MIM 602458
UniProt ID Q99523

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SORT1 Products

Required fields are marked with *

My Review for All SORT1 Products

Required fields are marked with *

0
cart-icon