"SOX2" Related Products

Expand
Expand
Expand

Recombinant Human SOX2 protein

Cat.No.: SOX2-67H
Product Overview: Recombinant human Sox2 cDNA (317 aa) was constructed with with flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain at the C terminus was expressed in E. coli.
Source: E. coli
Species: Human
Form: 0.50 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
Bio-activity: Cellular Toxicity: This recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium. Suggested reprogramming protein concentration is between 0.5 to 8 ug / ml for both human and mouse fibroblast cells applications.Biolog
AA Sequence: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRL GAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSM SYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS GPVPGTAINGTLPLSHMESGGGGSPGRRRRRRRRRRR
Purity: >95% by SDS-PAGE
Applications: 1. May be used for in vitro human Sox2 mediated iPS generation mechanism, or its gene specific transcription regulation study with intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for Sox2 protein-protein interaction mapping.4. May be used for specific antibody production.
Storage: Recombinant Human Sox2-11R is stable for six months at -20centigrade to -80centigrade. Store thawed tube at 4centigrade for seven days. Multiple freeze/thaw cycles may result in significant loss of activity.
Gene Name: SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ]
Official Symbol: SOX2
Synonyms: SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413;
Gene ID: 6657
mRNA Refseq: NM_003106
Protein Refseq: NP_003097
MIM: 184429
UniProt ID: P48431
Chromosome Location: 3q26.3-q27
Pathway: Wnt Signaling Pathway and Pluripotency, organism-specific biosystem;
Function: DNA binding; DNA binding; miRNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.