Recombinant Human SP1, His-tagged
Cat.No. : | SP1-30987TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 645-778 a.a. |
Description : | The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Up-regulated in adenocarcinomas of the stomach (at protein level). |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF |
Sequence Similarities : | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
Gene Name | SP1 Sp1 transcription factor [ Homo sapiens ] |
Official Symbol | SP1 |
Synonyms | SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1; |
Gene ID | 6667 |
mRNA Refseq | NM_001251825 |
Protein Refseq | NP_001238754 |
MIM | 189906 |
Uniprot ID | P08047 |
Chromosome Location | 12q13.1 |
Pathway | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; |
Function | DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding; |
◆ Recombinant Proteins | ||
SP1-5336R | Recombinant Rat SP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP1-2093H | Active Recombinant Human SP1, HA & Flag-tagged | +Inquiry |
SP1-6339H | Recombinant Human SP1 Protein (Leu260-Ala591), N-His tagged | +Inquiry |
SP1-113H | Recombinant Human SP1 Protein, His-tagged | +Inquiry |
SP1-1157H | Active Recombinant Human Sp1 Transcription Factor | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SP1 Products
Required fields are marked with *
My Review for All SP1 Products
Required fields are marked with *