Recombinant Human SP1, His-tagged

Cat.No. : SP1-30987TH
Product Overview : Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 645-778 a.a.
Description : The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Up-regulated in adenocarcinomas of the stomach (at protein level).
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF
Sequence Similarities : Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name SP1 Sp1 transcription factor [ Homo sapiens ]
Official Symbol SP1
Synonyms SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1;
Gene ID 6667
mRNA Refseq NM_001251825
Protein Refseq NP_001238754
MIM 189906
Uniprot ID P08047
Chromosome Location 12q13.1
Pathway Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem;
Function DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SP1 Products

Required fields are marked with *

My Review for All SP1 Products

Required fields are marked with *

0
cart-icon