Recombinant Human SP1 protein(581-660 aa), C-His-tagged

• Cat.No.: SP1-2587H
• Product Overview: Recombinant Human SP1 protein(P08047)(581-660 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 581-660 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW

Gene Information

• Gene Name: SP1 Sp1 transcription factor [ Homo sapiens ]
• Official Symbol: SP1
• Synonyms: SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1
• Gene ID: 6667
• mRNA Refseq: NM_001251825
• Protein Refseq: NP_001238754
• MIM: 189906
• UniProt ID: P08047