Recombinant Human SP1 protein(581-660 aa), C-His-tagged
Cat.No. : | SP1-2587H |
Product Overview : | Recombinant Human SP1 protein(P08047)(581-660 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 581-660 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW |
Gene Name | SP1 Sp1 transcription factor [ Homo sapiens ] |
Official Symbol | SP1 |
Synonyms | SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1; |
Gene ID | 6667 |
mRNA Refseq | NM_001251825 |
Protein Refseq | NP_001238754 |
MIM | 189906 |
UniProt ID | P08047 |
◆ Recombinant Proteins | ||
SP1-30987TH | Recombinant Human SP1, His-tagged | +Inquiry |
SP1-1956H | Recombinant Human SP1 protein, His & GST-tagged | +Inquiry |
SP1-16H | Recombinant Human SP1 protein, His-tagged | +Inquiry |
SP1-30608TH | Recombinant Human SP1 | +Inquiry |
SP1-11938Z | Recombinant Zebrafish SP1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SP1 Products
Required fields are marked with *
My Review for All SP1 Products
Required fields are marked with *
0
Inquiry Basket