Recombinant Human SPR protein, MBP-His-Avi-tagged, Biotinylated
| Cat.No. : | SPR-4607H |
| Product Overview : | Biotinylated Recombinant Human SPR protein(P35270)(1-261 aa), fused with N-terminal MBP-tagged and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 1-261 aa |
| Conjugation/Label : | Biotin |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 75.8 kDa |
| AASequence : | MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Conjugation : | Biotin |
| Gene Name | SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ] |
| Official Symbol | SPR |
| Synonyms | SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; short chain dehydrogenase/reductase family 38C, member 1; |
| Gene ID | 6697 |
| mRNA Refseq | NM_003124 |
| Protein Refseq | NP_003115 |
| MIM | 182125 |
| UniProt ID | P35270 |
| ◆ Recombinant Proteins | ||
| SPR-681H | Recombinant Human SPR Protein, His/GST-tagged | +Inquiry |
| SPR-3654H | Recombinant Human SPR protein, His-tagged | +Inquiry |
| SPR-0242H | Recombinant Human SPR Protein (M1-K261), His tagged | +Inquiry |
| SPR-190H | Recombinant Full Length Human Sepiapterin Reductase, His-tagged | +Inquiry |
| SPR-1089HFL | Recombinant Full Length Human SPR Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPR Products
Required fields are marked with *
My Review for All SPR Products
Required fields are marked with *
