Recombinant Human SPR protein, MBP-His-Avi-tagged, Biotinylated

• Cat.No.: SPR-4607H
• Product Overview: Biotinylated Recombinant Human SPR protein(P35270)(1-261 aa), fused with N-terminal MBP-tagged and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 1-261 aa
• Conjugation/Label: Biotin
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 75.8 kDa
• AASequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ]
• Official Symbol: SPR
• Synonyms: SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; short chain dehydrogenase/reductase family 38C, member 1
• Gene ID: 6697
• mRNA Refseq: NM_003124
• Protein Refseq: NP_003115
• MIM: 182125
• UniProt ID: P35270